JobDrop

Marqeta jobs

Browse current Marqeta openings that JobDrop found directly from the company's careers source.

Senior Manager, Benefits

Marqeta · Remote, US · Posted 2026-08-14 · 8+ years

As Marqeta's Senior Manager, Benefits, you will own the strategy, design, and operational excellence of our US and global benefits programs. You'll be the most senior benefits leader in the organization—setting the vision for how Marqeta invests in employee wellbeing, leading a lean benefits function, and partnering wi

marqetaprogramstrategyemployeefromprocessdesignleadership

Junior Account Manager

Marqeta · Remote, US · First seen 2026-08-11 · 5+ years

## Position Details - This is a staffing agency position. The selected candidate will be employed by TCWGlobal. - This compensation for this position is anticipated to be $55.00 - $65.00 per hour. - This assignment is anticipated to last approximately 6 months, with the possibility of an additional period as determined

GoExcel

Senior RFP Analyst

Marqeta · Toronto, ON, Canada; Vancouver, BC, Canada · First seen 2026-08-11

Marqeta is looking for a Senior Analyst, RFP Operations to support and scale our RFP, RFI, and DDQ response process. In this role, you will act as the day-to-day coordinator for live RFPs, partnering with Sales, Solutions, Product, Legal, Compliance, Cybersecurity, Marketing, and other cross-functional teams to keep pr

Salesforce

Staff Salesforce Architect

Marqeta · Remote, US · Posted 2026-08-10 · 10+ years

As Salesforce Architect, you will be the technical backbone of Marqeta's Business Systems team, a lean, high-impact group that serves as the internal Salesforce platform team for Go-To-Market (GTM), Product Support, and Legal, Risk & Compliance (LRC). This is a heavily hands-on lead individual contributor role, you wil

Salesforce

Associate Account Manager (Core)

Marqeta · Toronto, ON, Canada; Vancouver, BC, Canada · Posted 2026-08-06 · 1-3 years

Marqeta is a leader in the fintech space, redefining what is possible within financial services and sitting at the vanguard of embedded finance. We're growing fast and that means building a team that can grow with us. The Associate Account Manager role is designed for someone who is eager to build deep expertise in pay

SalesforceExcel

Technical Success Analyst - EU / UK

Marqeta · London, UK · Posted 2026-08-05 · 5+ years

Marqeta is looking for a Technical Success Senior Analyst to join our operations team and play a critical role in delivering Marqeta’s cutting-edge card issuing and payments platform to new customers. You’ll lead the technical onboarding of standardized products, support customers through implementation, and become a t

RESTSQL

Technical Program Manager - EU / UK

Marqeta · London, UK; Remote, UK · Posted 2026-08-05 · 3+ years

As a Technical Program Manager at Marqeta, you will be responsible for leading technical workstreams or initiatives, coordinating work across engineering teams to deliver complex projects on time and within scope. The Product Operations and Technical Program Management team operates as an integral component of the Stra

TechnicalProgrammarqetastatusopportunityfromengineeringproduct

Senior Technology Auditor

Marqeta · Warsaw, Poland · Posted 2026-08-04 · 5+ years

As Marqeta’s Senior Technology Auditor, you will play a pivotal role in ensuring the integrity and security of our technology operations by conducting comprehensive IT audits and SOX testing. You’ll be part of a collaborative Internal Audit team that works across departments to evaluate and strengthen Marqeta’s IT cont

GoAWSAzureKubernetesJenkins

Corporate/Opex Finance Manager

Marqeta · Remote, US · Posted 2026-08-03 · 8+ years

As Marqeta's Corporate/Opex Finance Manager, you will own a critical slice of the company's operating expense and headcount planning end-to-end — serving as the trusted finance partner to a functional leader while helping build the systems and rigor Corporate FP&A needs at public-company scale. You'll take ownership of

CorporateOpexFinancemarqetapartnerfunctionalthemmodel

Senior Production Support Engineer

Marqeta · Remote, US · Posted 2026-07-28 · 8+ years

As a Senior Production Support Engineer at Marqeta, you will play a pivotal role in our commitment to customer satisfaction and the seamless operation of our products and services. You will serve as the first line of contact for our customers, adeptly handling and resolving complex technical issues while translating te

ProductionSupportEngineermarqetatechnicalproductfromprocess

Key Account Manager

Marqeta · Remote, US · Posted 2026-07-27 · 12+ years

At Marqeta we’ve built an innovative platform that is a leader in the fintech space. We are redefining what is capable within financial services and are at the vanguard of embedded finance. We are looking to accelerate our growth by adding teammates who have the right qualifications and drive to meet the needs of our c

KeyAccountmarqetadrivegrowthsolutionsfromprocess

Senior Demand Generation Manager - EU/UK

Marqeta · London, UK · Posted 2026-07-24 · 8+ years

Marqeta is seeking a high-energy Senior Demand Generation Manager to lead demand generation strategy across our global sales segments, spanning North America and EMEA. In this strategic role, you'll set the direction for integrated campaigns that generate qualified pipeline for our commercial and enterprise sales teams

Salesforce

Business Systems Product Manager

Marqeta · Toronto, ON, Canada; Vancouver, BC, Canada · Posted 2026-07-23 · 5+ years

As Product Manager, Business Systems, you will own the product roadmap for the platforms and integrations that power Marqeta's critical business functions. You will be the connective tissue between business stakeholders and the Business Systems engineering teams translating operational needs into a clear, prioritized b

SystemsProductmarqetastakeholdersmanagementroadmapneedsplatforms

Operations Learning & Development Specialist

Marqeta · Warsaw, Poland · Posted 2026-07-20 · 4+ years

As Marqeta’s Operations Learning & Development Specialist, to serve as the cornerstone of training excellence for our Global Contact Center Teams. In this high-impact role, you will own the full lifecycle of learning — from needs analysis and content design to delivery, facilitation, and continuous improvement — across

OperationsLearningDevelopmentSpecialisttrainingmarqetadesigncontent

Counsel, Product & Regulatory

Marqeta · Remote, US · Posted 2026-07-15 · 5+ years

To help advance our vision of modern money movement, Marqeta is looking for a Counsel, Product and Regulatory who is enthusiastic about payments technology and its potential for positive impact in peoples’ lives. You will help drive high-profile cross-functional initiatives across the business involving a variety of co

CounselProductRegulatorymarqetalegalpaymentsfinancialability

Staff Software Engineer - Banking and Money Movement

Marqeta · Toronto, ON, Canada; Vancouver, BC, Canada · Posted 2026-07-14 · 8+ years

Marqeta is seeking an experienced Staff Software Engineer to independently drive the identification and delivery of complex software solutions on our Banking and Money Movement Team. In this role, you will lead end-to-end delivery across multi-component systems and multi-milestone initiatives, taking full ownership of

PythonJavaSQLMySQLAWSKubernetesDocker

Assistant Manager, Bank Partnerships

Marqeta · Toronto, ON, Canada; Vancouver, BC, Canada · Posted 2026-07-14

The Partner Operations team is a key division within Marqeta's broader Go-To-Market Organisation, with two essential functions. The bank and network partnership teams drive global strategies to enhance our core technology and capabilities across credit, debit, prepaid card, and money movement offerings. Meanwhile, the

AssistantBankPartnershipsmarqetasupportoperationalrelationshipprogram

Principal Software Engineer

Marqeta · Remote, US · Posted 2026-07-08 · 12+ years

As Marqeta’s Principal Software Engineer on the Core Issuing & Processing team, you will work across the entire domain to stand up and drive high-impact projects for our customers from inception to completion. You will take on highly technical initiatives that optimize our issuing and processing engines, own the techni

SoftwareEngineermarqetaissuingprocessingtechnicaldriveengineering

Senior Manager, Software Engineering

Marqeta · Toronto, ON, Canada; Vancouver, BC, Canada · Posted 2026-07-08

As Marqeta's Senior Manager, Software Engineering, you will lead and evolve our Credit onboarding team. This is a critical leadership role responsible for scaling the next generation of innovative credit onboarding platforms that power modern fintech experiences. You will lead the Credit onboarding engineering team res

SoftwareEngineeringmarqetacreditleaddriveonboardinghigh

Senior Software Engineer, Frontend (React-Native)

Marqeta · Toronto, ON, Canada; Vancouver, BC, Canada · Posted 2026-07-07 · 5+ years

Marqeta is on a mission to change the way money moves. We’re one of the earliest enablers of embedded finance, a market opportunity sized up in the trillions. Our card issuing platform provides unprecedented flexibility and control for companies to issue cards, authorize transactions, and manage payment operations in r

React

Associate Account Manager

Marqeta · Toronto, ON, Canada; Vancouver, BC, Canada · Posted 2026-07-01 · 3+ years

Marqeta is looking for a driven, curious, and entrepreneurial Associate Account Manager to join our Global Strategic Partnerships team. In this role, you’ll partner closely with cross-functional teams to support one of our global strategic accounts - building deep relationships, uncovering revenue-generating opportunit

GoExcel

Manager, Software Engineering - Identity Platform

Marqeta · Remote, US · Posted 2026-06-29

As Marqeta's Manager, Software Engineering within our Risk, Fraud and Disputes pod, you will lead the design, development, and execution of our Identity Platform. You will be responsible for building and operating systems that manage the full KYC lifecycle, from Customer Identification Program (CIP) verification at acc

PythonJavaSpringAirflow

Credit Risk Senior Manager

Marqeta · Remote, US · Posted 2026-06-25 · 8+ years

As Marqeta’s Credit Risk Senior Manager, you will lead our credit risk and pricing strategy, helping us launch and scale credit programs from the ground up. You will drive innovation to establish best in class credit strategies in partnership with internal stakeholders and external bank partners and customers. You will

CreditRiskmarqetastrategypartnerssupportcardfrom

Risk and Compliance Manager (Marketing Compliance)

Marqeta · Remote, US · Posted 2026-06-23 · 5+ years

Reporting to and supporting the Senior Compliance Manager, the Risk and Compliance Manager will assist with Marqeta's comprehensive consumer compliance program, including UDAP/UDAAP, marketing compliance, and Compliance advisory support across various consumer protection regulations. The ideal candidate will be someone

RiskComplianceMarketingmarqetamanagersupportpremiumnational

Technical Success Manager

Marqeta · Toronto, ON, Canada; Vancouver, BC, Canada · Posted 2026-06-22 · 5+ years

We’re looking for a Technical Success Manager to join our Implementation team and play a critical role in delivering Marqeta’s cutting-edge card issuing and payments platform to new customers. You’ll lead the technical onboarding of standardized products, support customers through implementation, and become a trusted v

RESTSQL

Senior Director, Investor Relations

Marqeta · Oakland, CA, US · Posted 2026-06-18 · 15+ years

As Marqeta's Senior Director, Investor Relations, you will lead and evolve the company's IR program during a pivotal period of growth and strategic transformation. Reporting directly to the SVP, Head of IR, you will serve as the primary architect of Marqeta's investment narrative and a trusted partner to executive lead

DirectorInvestorRelationsmarqetapaymentsfinancialinvestmentfinance

Technical Success Analyst

Marqeta · Toronto, ON, Canada; Vancouver, BC, Canada · Posted 2026-06-16 · 3+ years

As a Technical Success Analyst and a valued member of the Technical Success team at Marqeta, you will serve as a trusted technical and payments advisor for our customer base. The Technical Success team sits within our Go-To Market (GTM) organization and is on the critical path for revenue. In an API-first, technology d

RESTSQL

VP, Total Rewards

Marqeta · Remote, US · Posted 2026-06-15 · 10+ years

As Marqeta’s VP, Total Rewards you will play a pivotal role in shaping and executing the company's global total rewards strategy. This individual will lead our Compensation and Benefits functions, ensuring alignment with business objectives, market trends, and regulatory requirements. This role will play a strategic ro

TotalRewardscompensationmarqetaprogramsfromsupportlead

Director Marketing Analytics

Marqeta · Remote, US · Posted 2026-06-12 · 10+ years

Marqeta is seeking a Director of Marketing Analytics to serve as the intelligence backbone of our go-to-market engine. This is a senior leadership role for someone who doesn't just measure marketing — they shape it. You will define how Marqeta understands marketing's contribution to revenue, build the analytical infras

SQLSnowflakeBigQuerySalesforceTableauLooker

FP&A Manager, GTM Finance - Credit Products

Marqeta · Remote, US · Posted 2026-06-09 · 6-8 years

As Marqeta’s FP&A Manager, GTM Finance — Credit Products, you will focus on Marqeta's credit business by partnering with Sales, Legal, Product, Credit Risk, and Capital Markets to model pricing, evaluate profitability, and structure deals that win business while protecting unit economics. You'll flex in on debit and pr

Excel

Director, GTM Operations

Marqeta · Oakland, CA, US · Posted 2026-05-29 · 10+ years

At Marqeta, we're on a mission to revolutionize the way money moves. As pioneers in the field of embedded finance, we're tapping into a market opportunity that's worth trillions. Our card issuing platform offers unparalleled flexibility and control, enabling companies to issue cards, authorize transactions, and manage

DirectorGTMOperationsmarqetasalesoperationalsupportprocesses

Investor Relations Manager

Marqeta · Oakland, CA, US · Posted 2026-05-27 · 4-6 years

As Marqeta’s Investor Relations Manager you will support the company’s investor relations efforts. The team is focused on maximizing shareholder value through effective communication of our value proposition. To do this we must tell a cohesive and data-driven story about our strategy, financial results, and operations

Excel

Assistant General Counsel, Corporate

Marqeta · Remote, US · Posted 2026-05-21 · 10-15 years

As Marqeta’s Assistant General Counsel, Corporate you will be a senior member of the Corporate Legal team. You will be the right hand to the Deputy General Counsel on all things corporate and securities — owning core SEC reporting workstreams, driving corporate governance, supporting the Board and its committees, and s

AssistantGeneralCounselCorporatemarqetalegalboardsupport

Senior Manager, Network Operations

Marqeta · Toronto, ON, Canada; Vancouver, BC, Canada · Posted 2026-05-21 · 7+ years

As Marqeta’s Senior Manager, Network Operations, you will lead our Network Operations team through a critical infrastructure modernization initiative. This role combines strategic leadership with hands-on technical expertise as we transition from traditional data center infrastructure toward a more cloud-native archite

AWSTerraform

Senior Director, Operations - EU / UK

Marqeta · London, UK · Posted 2026-05-19 · 15+ years

Marqeta is looking for a Senior Director, Market Operations to lead our European go-to-market execution across Solution Engineering, Delivery, and Program Implementation. Reporting to the European Market Owner, you will own the end-to-end customer journey—from pre-sales solutioning through to program launch and expansi

DirectorOperationsdeliverymarqetaoperationaleuropeanprogramcard

Manager, Software Engineering - Identity Platform

Marqeta · Toronto, ON, Canada; Vancouver, BC, Canada · Posted 2026-05-13

As Marqeta's Manager, Software Engineering within our Risk, Fraud and Disputes pod, you will lead the design, development, and execution of our Identity Platform. You will be responsible for building and operating systems that manage the full KYC lifecycle, from Customer Identification Program (CIP) verification at acc

PythonJavaSpringAirflow

Senior Manager, Commercialization

Marqeta · Remote, US · Posted 2026-05-12 · 8+ years

At Marqeta, we're on a mission to revolutionize the way money moves. As pioneers in the field of embedded finance, we're tapping into a market opportunity that's worth trillions. Our card issuing platform offers unparalleled flexibility and control, enabling companies to issue cards, authorize transactions, and manage

Commercializationmarqetaopportunityproductgo-to-marketfromfinancialfinance

Credit Risk Manager

Marqeta · Remote, US · Posted 2026-05-08 · 5+ years

As Marqeta’s Credit Risk Manager you will lead credit underwriting and account management for our SMB and commercial card programs, helping us launch and scale credit offerings for small, mid-market, and commercial businesses. You will drive innovation to establish best in class credit strategies in partnership with in

CreditRiskmarqetacommercialcardmanagementdataunderwriting

Key Account Manager, Global Strategic Partnerships

Marqeta · London, UK · Posted 2026-05-08 · 10+ years

As Marqeta’s Key Account Manager, you will partner with a cross-functional team and manage one of our global strategic accounts. You will bring a strong track record of growth and deep relationship-building experience to provide exceptional client service, uncover revenue-generating opportunities and workable solutions

KeyAccountGlobalStrategicPartnershipsmarqetastrongtrack

Key Account Executive - EU / UK

Marqeta · London, UK; Remote, UK · Posted 2026-05-01 · 10+ years

As Marqeta’s Key Account Executive in the UK, you will be passionate about scaling the success of our business in Europe. This exciting role is ideal for individuals seeking to go deep in all aspects of complex business and technical engagements and will span multiple areas of development: (1) Cultivating and managing

KeyAccountExecutivemarqetaprocessopportunitiessalesfinancial

Senior Account Executive - EU / UK

Marqeta · London, UK; Remote, UK · Posted 2026-04-13 · 10+ years

As Marqeta’s Senior Account Executive based in the UK, you will lead the expansion and scaling of our most impactful partnerships across larger Fintech, Financial Institution, banking, and embedded finance businesses. This highly strategic role requires a critical, pre-existing understanding of the entire payments ecos

AccountExecutivemarqetapaymentsopportunitiesprocesscomplexsales

Senior Account Manager

Marqeta · Remote, US · Posted 2026-03-05 · 5+ years

As Marqeta’s Senior Account Manager, you will support one of our largest global strategic accounts, serving as the primary point of contact for day-to-day operations and ongoing client needs. Working closely with a cross-functional team, you will help ensure seamless execution, proactive communication, and high-quality

Accountmarqetasupportstrategicdriveoperationsstrongknowledge

Senior Director, Sales

Marqeta · Remote, US · Posted 2026-02-12 · 15+ years

As Marqeta’s Senior Director, Sales (Financial Services), you will manage a team tasked solutioning new and novel financial products to F1000 organizations. Your team will also be responsible for growing a portfolio of Marqeta’s largest and most strategic customers. Marqeta partners closely with the most innovative com

DirectorSalesmarqetafromfinancialmostsolutionspayments

Senior Manager, IT Product Management

Marqeta · Remote, US · Posted 2025-06-19 · 10+ years

We are seeking a seasoned Senior Manager to lead two critical and complementary functions within Business Technology: IT Product Management and IT Software Asset Management. This is a high-impact leadership role responsible for bridging the gap between Business Technology (BT) capabilities and business needs — ensuring

ProductManagementtechnologymarqetastrategyleadsystemsenterprise